PDB entry 6bon

View 6bon on RCSB PDB site
Description: Crystal structure of 2-methylcitrate synthase from Aspergillus fumigatus with oxaloacetate and coenzyme-A.
Class: transferase
Keywords: mcsA, 2-methylcitrate synthase, citrate synthase, TRANSFERASE
Deposited on 2017-11-20, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bona_
  • Chain 'B':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bonb_
  • Heterogens: OAA, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bonA (A:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bonA (A:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bonB (B:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bonB (B:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk