PDB entry 6bol

View 6bol on RCSB PDB site
Description: Crystal structure of mutant 2-methylcitrate synthase mcsAG419A from Aspergillus fumigatus.
Class: transferase
Keywords: mcsA, 2-methylcitrate synthase, citrate synthase, TRANSFERASE
Deposited on 2017-11-20, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89
      • engineered mutation (394)
    Domains in SCOPe 2.07: d6bola_
  • Chain 'B':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) [TaxId:451804]
    Gene: mcsA, AFUB_094700
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0YD89
      • engineered mutation (394)
    Domains in SCOPe 2.07: d6bolb_
  • Heterogens: PO4, OAA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bolA (A:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhyafqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bolA (A:)
    epdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpeeg
    irfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpqh
    ildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllakip
    rvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdheg
    gnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftddd
    vrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseiap
    avltehgktknphpnvdaasgvlfyhyafqqplyytvtfgvsralgplvqliwdralglp
    ierpksinllglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bolB (B:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhyafqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bolB (B:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhyafqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglk