PDB entry 6bng

View 6bng on RCSB PDB site
Description: Structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Acinetobacter baumannii
Class: transferase
Keywords: SSGCID, Acinetobacter baumannii, 2-dehydro-3-deoxyphosphooctonate aldolase, aldolase, kdsA, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2017-11-16, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Acinetobacter baumannii (strain AB307-0294) [TaxId:557600]
    Gene: kdsA, ABBFA_001556
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7H226 (8-288)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d6bnga1, d6bnga2
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Acinetobacter baumannii (strain AB307-0294) [TaxId:557600]
    Gene: kdsA, ABBFA_001556
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bngb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bngA (A:)
    mahhhhhhkpqevvrlgdiqmanhlpfvlfggmnvleskdlafeiaetyidickrldipy
    vfkasfdkanrsslhsfrgpglekgiewlgdikkhfnvpiitdvhepyqaapvaevadii
    qlpaflsrqtdlveamaktqaiinikkaqflaphemrhilhkcleagndklilcergsaf
    gynnlvvdmlgfdimkemnvpvffdvthalqtpggrsdsaggrraqittlaragmatgla
    glfleshpdpdkakcdgpsalrlsqlepflaqlkeldtlvkgfkkldth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bngA (A:)
    hhkpqevvrlgdiqmanhlpfvlfggmnvleskdlafeiaetyidickrldipyvfkasf
    dkanrsslhsfrgpglekgiewlgdikkhfnvpiitdvhepyqaapvaevadiiqlpafl
    srqtdlveamaktqaiinikkaqflaphemrhilhkcleagndklilcergsafgynnlv
    vdmlgfdimkemnvpvffdvthalqtpgggrraqittlaragmatglaglfleshpdpdk
    akcdgpsalrlsqlepflaqlkeldtlvkgfkkldth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bngB (B:)
    mahhhhhhkpqevvrlgdiqmanhlpfvlfggmnvleskdlafeiaetyidickrldipy
    vfkasfdkanrsslhsfrgpglekgiewlgdikkhfnvpiitdvhepyqaapvaevadii
    qlpaflsrqtdlveamaktqaiinikkaqflaphemrhilhkcleagndklilcergsaf
    gynnlvvdmlgfdimkemnvpvffdvthalqtpggrsdsaggrraqittlaragmatgla
    glfleshpdpdkakcdgpsalrlsqlepflaqlkeldtlvkgfkkldth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bngB (B:)
    kpqevvrlgdiqmanhlpfvlfggmnvleskdlafeiaetyidickrldipyvfkasfdk
    anrsslhsfrgpglekgiewlgdikkhfnvpiitdvhepyqaapvaevadiiqlpaflsr
    qtdlveamaktqaiinikkaqflaphemrhilhkcleagndklilcergsafgynnlvvd
    mlgfdimkemnvpvffdvthalqtprraqittlaragmatglaglfleshpdpdkcdgps
    alrlsqlepflaqlkeldtlvkgfkkldth