PDB entry 6bmy

View 6bmy on RCSB PDB site
Description: Non-receptor Protein Tyrosine Phosphatase SHP2 in Complex with Allosteric Inhibitors SHP099 and SHP844
Class: hydrolase/hydrolase inhibitor
Keywords: SHP2, PTPN11, protein tyrosine phosphatase, phosphatase, allosteric inhibitor, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2017-11-15, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bmya1, d6bmya2, d6bmya3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bmyb1, d6bmyb2, d6bmyb3
  • Heterogens: 5OD, DYV, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bmyA (A:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bmyA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsnpgdftlsvrrngavthikiqntgdyyd
    lyggekfatlaelvqyymehhgqlkgdvielkyplncadptserwfhghleklltekgkh
    gsflvrespgdfvlsvrtgskvthvmircqelkydvgggerfdsltdlvehykknpmvet
    lgtvlqlkqplnttrinaaeiesrvrelsklqgfweefetlqqqeckllysrkegqrqen
    knknryknilpfdhtrvvlhdgdppvsdyinaniimppkksyiatqgclqntvndfwrmv
    fqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklsk
    vgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigr
    tgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bmyB (B:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bmyB (B:)
    rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymehhgqldvielkyplncadptserwfhghlsgaeklltekg
    khgsflvrepgdfvlsvrtskvthvmircqelkydvgggerfdsltdlvehykknpmvet
    lgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenk
    nknryknilpfdhtrvvlhvsdyinaniimppkksyiatqgclqntvndfwrmvfqensr
    vivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgnt
    ertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfiv
    idilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl