PDB entry 6bmw

View 6bmw on RCSB PDB site
Description: Non-receptor Protein Tyrosine Phosphatase SHP2 in Complex with Allosteric Inhibitors SHP099 and SHP504
Class: hydrolase/hydrolase inhibitor
Keywords: SHP2, PTPN11, protein tyrosine phosphatase, phosphatase, allosteric inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-11-15, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bmwa1, d6bmwa2, d6bmwa3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bmwb1, d6bmwb2, d6bmwb3
  • Heterogens: 5OD, DZS, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bmwA (A:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bmwA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpskpgdftlsvrrngavthikiqntgdyyd
    lyggekfatlaelvqyymehhgqlkdvielkyplncadptserwfhghleaeklltekgk
    hgsflvrespgdfvlsvrtgskvthvmircqelkydvgggerfdsltdlvehykknpmve
    tlgtvlqlkqplnttrinaaeiesrvrelsklqgfweefetlqqqeckllysrkegqrqe
    nknknryknilpfdhtrvvlhpvsdyinaniimpksyiatqgclqntvndfwrmvfqens
    rvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgn
    tertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfi
    vidilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bmwB (B:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bmwB (B:)
    rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymehhgqlkdvielkyplncadptserwfhghlaeklltekgk
    hgsflvrepgdfvlsvrtskvthvmircqelkydvgggerfdsltdlvehykknpmvetl
    gtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenkn
    knryknilpfdhtrvvlhvsdyinaniimppkksyiatqgclqntvndfwrmvfqensrv
    ivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgnte
    rtvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfivi
    dilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl