PDB entry 6bmg

View 6bmg on RCSB PDB site
Description: Structure of Recombinant Dwarf Sperm Whale Myoglobin (Oxy)
Class: oxygen storage
Keywords: myoglobin, oxygen storage-transport complex, globin, OXYGEN STORAGE
Deposited on 2017-11-14, released 2017-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Kogia sima [TaxId:9752]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02184 (1-153)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d6bmga_
  • Chain 'B':
    Compound: Myoglobin
    Species: Kogia sima [TaxId:9752]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02184 (1-153)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d6bmgb_
  • Heterogens: HEM, OXY, CD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bmgA (A:)
    mvlsegewqlvlhvwakveadiaghgqdilirlfkhhpetlekfdrfkhlkseaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    padfgadaqgamskalelfrkdiaakykelgyqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bmgB (B:)
    mvlsegewqlvlhvwakveadiaghgqdilirlfkhhpetlekfdrfkhlkseaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    padfgadaqgamskalelfrkdiaakykelgyqg