PDB entry 6bm5

View 6bm5 on RCSB PDB site
Description: Crystal Structure of the MetH Reactivation Domain bound to AdoMet
Class: transferase
Keywords: C-terminal domain, reactivation domain, MetH-AdoMet, MetH-SAM, TRANSFERASE
Deposited on 2017-11-13, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: metH, b4019, JW3979
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bm5a_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bm5A (A:)
    gskkprtppvtleaardndfafdwqaytppvahrlgvqeveasietlrnyidwtpffmtw
    slagkypriledevvgveaqrlfkdandmldklsaektlnprgvvglfpanrvgddieiy
    rdetrthvinvshhlrqqtektgfanycladfvapklsgkadyigafavtggleedalad
    afeaqhddynkimvkaladrlaeafaeylhervrkvywgyapnenlsneelirenyqgir
    papgypacpehtekatiwellevekhtgmkltesfamwpgasvsgwyfshpdskyyavaq
    iqrdqvedyarrkgmsvteverwlapnlgydad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bm5A (A:)
    tppvtleaardndfafdwqaytppvahrlgvqeveasietlrnyidwtpffmtwslagky
    priledevvgveaqrlfkdandmldklsaektlnprgvvglfpanrvgddieiyrdetrt
    hvinvshhlrqqtektgfanycladfvapklsgkadyigafavtggleedaladafeaqh
    ddynkimvkaladrlaeafaeylhervrkvywgyapnenlsneelirenyqgirpapgyp
    acpehtekatiwellevekhtgmkltesfamwpgasvsgwyfshpdskyyavaqiqrdqv
    edyarrkgmsvteverwlapnlgyd