PDB entry 6bla

View 6bla on RCSB PDB site
Description: Structure of AMM01 Fab, an anti EBV gH/gL neutralizing antibody
Class: immune system
Keywords: antibody, Fab, EBV, gH/gL, IMMUNE SYSTEM
Deposited on 2017-11-09, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: AMM01 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BLA (0-End)
  • Chain 'L':
    Compound: AMM01 Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BLA (Start-215)
    Domains in SCOPe 2.07: d6blal1, d6blal2
  • Heterogens: EDO, PEG, GOL, CL, TRS, 2PE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6blaL (L:)
    syeltqppsvsvapgqratitcgghnigaknvhwyqqkpgqapvlviqydsdrpsgiper
    fsgsnsgstatltisrveagdeadyycqvwdsgrghplyvfgggtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6blaL (L:)
    yeltqppsvsvapgqratitcgghnigaknvhwyqqkpgqapvlviqydsdrpsgiperf
    sgsnsgstatltisrveagdeadyycqvwdsgrghplyvfgggtkvtvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs