PDB entry 6bl8

View 6bl8 on RCSB PDB site
Description: Predicting the Conformational Variability of Abl Tyrosine Kinase Using Molecular Dynamics Simulations and Markov State Models
Class: transferase
Keywords: Abl, TRANSFERASE
Deposited on 2017-11-09, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (0-End)
      • conflict (103)
      • conflict (160)
      • conflict (212)
    Domains in SCOPe 2.07: d6bl8a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (0-271)
      • conflict (103)
      • conflict (160)
      • conflict (212)
    Domains in SCOPe 2.07: d6bl8b_
  • Heterogens: PVB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bl8A (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtftahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidpsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessisd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bl8A (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtftahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidpsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bl8B (B:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtftahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidpsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessisd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bl8B (B:)
    dkwemertditmkhklgygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikh
    pnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissameyle
    kknfihrdlaarnclvgenhlvkvadfglsrlmtgdtftahgakfpikwtapeslaynkf
    siksdvwafgvllweiatygmspypgidpsqvyellekdyrmerpegcpekvyelmracw
    qwnpsdrpsfaeihqafetmfqessisd