PDB entry 6bkw

View 6bkw on RCSB PDB site
Description: BTK complex with compound 12
Class: transferase
Keywords: BTK, inhibitor, water structure, kinase, TRANSFERASE
Deposited on 2017-11-09, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (1-265)
      • expression tag (266)
    Domains in SCOPe 2.07: d6bkwa1, d6bkwa2
  • Heterogens: DXM, SO4, FPZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bkwA (A:)
    mgsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmn
    lsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceamey
    leskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmy
    skfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimy
    scwhekaderptfkillsnildvmdenlyfqgeeymptehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkwA (A:)
    gsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnl
    sheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyl
    eskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmys
    kfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimys
    cwhekaderptfkillsnildvmden