PDB entry 6bkq

View 6bkq on RCSB PDB site
Description: Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D mutant in complex with 6'-SLN
Class: viral protein
Keywords: Influenza, Hemagglutinin, Receptor, VIRAL PROTEIN
Deposited on 2017-11-09, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-322)
      • expression tag (2-3)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6bkqa1, d6bkqa2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • conflict (122)
    Domains in SCOPe 2.07: d6bkqb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6bkqc1, d6bkqc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • conflict (122)
    Domains in SCOPe 2.07: d6bkqd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6bkqe1, d6bkqe2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • conflict (122)
    Domains in SCOPe 2.07: d6bkqf_
  • Heterogens: NAG, BMA, SIA, GAL, MAN, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bkqA (A:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqdqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkqA (A:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qdqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekqtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bkqB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkqB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bkqC (C:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqdqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkqC (C:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qdqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bkqD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkqD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bkqE (E:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqdqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkqE (E:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qdqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bkqF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkqF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf