PDB entry 6bkp

View 6bkp on RCSB PDB site
Description: Crystal structure of the A/Michigan/15/2014 (H3N2) influenza virus hemagglutinin apo form
Class: viral protein
Keywords: Influenza, Hemagglutinin, Receptor, VIRAL PROTEIN
Deposited on 2017-11-09, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1731408]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bkpa1, d6bkpa2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1731408]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bkpb_
  • Heterogens: NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bkpA (A:)
    adpgatlclghhavpngtivktitndrievtnatelvqnssigeicdsphqildgenctl
    idallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfn
    wtgvtqngtssacirrssssffsrlnwlthlnykypalnvtmpnneqfdklyiwgvhhpg
    tdkdqiflyaqssgritvstkrsqqavipnigsrpkirdipsrisiywtivkpgdillin
    stgnliaprgyfkirsgkssimrsdapigkcksecitpngsipndkpfqnvnritygacp
    ryvkhstlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkpA (A:)
    pgatlclghhavpngtivktitndrievtnatelvqnssigeicdsphqildgenctlid
    allgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwt
    gvtqngtssacirrssssffsrlnwlthlnykypalnvtmpnneqfdklyiwgvhhpgtd
    kdqiflyaqssgritvstkrsqqavipnigsrpkirdipsrisiywtivkpgdillinst
    gnliaprgyfkirsgkssimrsdapigkcksecitpngsipndkpfqnvnritygacpry
    vkhstlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bkpB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhnvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkpB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhnvyrdealnnrfqi