PDB entry 6bko

View 6bko on RCSB PDB site
Description: Crystal structure of the A/Wyoming/3/2003 (H3N2) influenza virus hemagglutinin D190E mutant apo form
Class: viral protein
Keywords: Influenza, Hemagglutinin, Receptor, VIRAL PROTEIN
Deposited on 2017-11-09, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:430416]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4GYF9 (4-End)
      • expression tag (2-3)
      • engineered mutation (183)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6bkoa1, d6bkoa2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:518976]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bkob_
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bkoA (A:)
    adpgatlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctl
    idallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfn
    wagvtqngtssackrrsnksffsrlnwlthlkykypalnvtmpnnekfdklyiwgvhhpv
    tdseqislyaqasgritvstkrsqqtvipnigfrprvrdissrisiywtivkpgdillin
    stgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacp
    ryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkoA (A:)
    pgatlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctlid
    allgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwa
    gvtqngtssackrrsnksffsrlnwlthlkykypalnvtmpnnekfdklyiwgvhhpvtd
    seqislyaqasgritvstkrsqqtvipnigfrprvrdissrisiywtivkpgdillinst
    gnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpry
    vkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bkoB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    rtkkqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkoB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    rtkkqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi