PDB entry 6bki

View 6bki on RCSB PDB site
Description: Crystal structure of T101A variant mouse cathepsin K at 2.94 Angstrom resolution.
Class: hydrolase
Keywords: cathepsin K, HYDROLASE, mouse
Deposited on 2017-11-08, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Mus musculus [TaxId:10090]
    Gene: CTSK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55097 (0-214)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6bkia_
  • Chain 'B':
    Compound: cathepsin k
    Species: Mus musculus [TaxId:10090]
    Gene: CTSK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55097 (0-214)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6bkib_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bkiA (A:)
    vpdsidyrkkgyvtpvknqgqcgscwafssagalegqlkkktgkllalspqnlvdcvten
    ygcgggymttafqyvqqnggidsedaypyvgqdescmynaaakaakcrgyreipvgneka
    lkravarvgpisvsidaslasfqfysrgvyydencdrdnvnhavlvvgygtqkgskhwii
    knswgeswgnkgyallarnknnacgitnmasfpkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bkiB (B:)
    vpdsidyrkkgyvtpvknqgqcgscwafssagalegqlkkktgkllalspqnlvdcvten
    ygcgggymttafqyvqqnggidsedaypyvgqdescmynaaakaakcrgyreipvgneka
    lkravarvgpisvsidaslasfqfysrgvyydencdrdnvnhavlvvgygtqkgskhwii
    knswgeswgnkgyallarnknnacgitnmasfpkm