PDB entry 6bkc

View 6bkc on RCSB PDB site
Description: Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody AR3B
Class: immune system
Keywords: HCV, broadly neutralizing antibodies, bNAbs, E2 core, IGHV1-69, IMMUNE SYSTEM
Deposited on 2017-11-08, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Polyprotein
    Species: Recombinant Hepatitis C virus HK6a/JFH-1 [TaxId:595609]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab AR3B heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BKC (0-113)
    • Uniprot P0DOX5 (114-End)
      • conflict (119)
  • Chain 'L':
    Compound: Fab AR3B light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BKC (0-105)
    • Uniprot Q8TCD0 (106-End)
    Domains in SCOPe 2.07: d6bkcl1, d6bkcl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6bkcL (L:)
    eieltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspqtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bkcL (L:)
    eieltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspqtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge