PDB entry 6bjz

View 6bjz on RCSB PDB site
Description: Crystal Structure of the Fab fragment of humanized 5c8 antibody containing the fluorescent non-canonical amino acid L-(7-hydroxycoumarin-4-yl)ethylglycine at pH 5.5
Class: immune system
Keywords: Immunoglobulin, Non Canonical Aminoacid, IMMUNE SYSTEM
Deposited on 2017-11-07, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 5c8 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BJZ (0-225)
  • Chain 'L':
    Compound: 5c8 Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BJZ (0-End)
    Domains in SCOPe 2.07: d6bjzl1, d6bjzl2
  • Heterogens: DV7, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6bjzL (L:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhswexpptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjzL (L:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhswexpptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr