PDB entry 6bji

View 6bji on RCSB PDB site
Description: Human ABO(H) blood group glycosyltransferase GTA D302C mutant
Class: transferase
Keywords: Blood group transferases, glycosyltransferases, enzymes, TRANSFERASE
Deposited on 2017-11-06, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (2-End)
      • expression tag (0-1)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d6bjia1, d6bjia2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bjiA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrw
    qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssr
    eaftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwh
    ceshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjiA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevrvsmrr
    memisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyer
    rpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhceshlnk
    yllrhkptkvlspeylwdqqllgwpavlrklrftav