PDB entry 6bje

View 6bje on RCSB PDB site
Description: Crystal Structure of Lysophospholipase A2 Conjugated with Phenylmethylsulfonyl Fluoride
Class: protein binding
Keywords: Lysophospholipases, PMSF, inhibitor, complex, PROTEIN BINDING
Deposited on 2017-11-06, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-protein thioesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA2, APT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bjea_
  • Chain 'B':
    Compound: Acyl-protein thioesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA2, APT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bjeb_
  • Heterogens: PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bjeA (A:)
    lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
    mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
    ytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvpvrfgaltae
    klrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjeA (A:)
    lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
    mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
    ytaltcphplagivalscwlplhrafpqngsakdlailqchgeldpmvpvrfgaltaekl
    rsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bjeB (B:)
    lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
    mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
    ytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvpvrfgaltae
    klrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bjeB (B:)
    lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
    mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
    ytaltcphplagivalscwlplhrangsakdlailqchgeldpmvpvrfgaltaeklrsv
    vtparvqfktypgvmhsscpqemaavkeflekllppv