PDB entry 6big

View 6big on RCSB PDB site
Description: Crystal structure of cobalt-substituted Synechocystis ACO
Class: oxidoreductase
Keywords: dioxygenase, cobalt, non-heme iron, beta propeller, OXIDOREDUCTASE
Deposited on 2017-11-02, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6biga_
  • Chain 'B':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bigb_
  • Chain 'C':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bigc_
  • Chain 'D':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bigd_
  • Heterogens: CO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bigA (A:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bigA (A:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bigB (B:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bigB (B:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bigC (C:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bigC (C:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bigD (D:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bigD (D:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt