PDB entry 6bif

View 6bif on RCSB PDB site
Description: Crystal Structure of Purine Nucleoside Phosphorylase Isoform 2 from Schistosoma mansoni in complex with 1-(4-amino-2-hydroxyphenyl)ethan-1-one
Class: transferase
Keywords: Purine Nucleoside Phosphorylase, TRANSFERASE
Deposited on 2017-11-01, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bifa_
  • Heterogens: DSJ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bifA (A:)
    mttpvvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpk
    ttvaghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlag
    ginrklksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkia
    qendfqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlav
    sliannsildaendvsinhekvlavaekradllqmwfkeiitrlpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bifA (A:)
    vvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpkttva
    ghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlagginr
    klksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqend
    fqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavslia
    nnsildaendvsinhekvlavaekradllqmwfkeiitrlp