PDB entry 6bib

View 6bib on RCSB PDB site
Description: 1.95 A resolution structure of Norovirus 3CL protease in complex with a triazole-based macrocyclic inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: protease, norovirus, Norwalk virus, antiviral inhibitors, triazole-based macrocyclic inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-11-01, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like protease
    Species: Norwalk virus [TaxId:524364]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83883 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d6biba1, d6biba2
  • Chain 'B':
    Compound: 3C-like protease
    Species: Norwalk virus [TaxId:524364]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83883 (7-End)
      • expression tag (5-6)
    Domains in SCOPe 2.07: d6bibb1, d6bibb2
  • Heterogens: DW7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bibA (A:)
    mhhhhhhapptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqag
    eftqfrfskkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrl
    vhgqsgmlltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa
    gegetale
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bibA (A:)
    happtlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfr
    fskkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsg
    mlllgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bibB (B:)
    mhhhhhhapptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqag
    eftqfrfskkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrl
    vhgqsgmlltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa
    gegetale
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bibB (B:)
    hhapptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqf
    rfskkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqs
    gmllgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa