PDB entry 6bi4

View 6bi4 on RCSB PDB site
Description: 2.9 Angstrom Resolution Crystal Structure of dTDP-Glucose 4,6-dehydratase (rfbB) from Bacillus anthracis str. Ames in Complex with NAD.
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, dTDP-Glucose 4, 6-dehydratase, NAD, LYASE
Deposited on 2017-10-31, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis str. Ames [TaxId:198094]
    Gene: rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (25-End)
      • expression tag (23-24)
    Domains in SCOPe 2.07: d6bi4a1, d6bi4a2
  • Chain 'B':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis str. Ames [TaxId:198094]
    Gene: rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (25-End)
      • expression tag (23-24)
    Domains in SCOPe 2.07: d6bi4b1, d6bi4b2
  • Chain 'C':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis str. Ames [TaxId:198094]
    Gene: rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (25-End)
      • expression tag (23-24)
    Domains in SCOPe 2.07: d6bi4c1, d6bi4c2
  • Chain 'D':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis str. Ames [TaxId:198094]
    Gene: rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (25-End)
      • expression tag (23-24)
    Domains in SCOPe 2.07: d6bi4d1, d6bi4d2
  • Heterogens: NI, NAD, SO4, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bi4A (A:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bi4A (A:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtdghdrryainaekmknefdwepkytfeqglqetvqwy
    ekneewwkplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bi4B (B:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bi4B (B:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtghdrryainaekmknefdwepkytfeqglqetvqwye
    kneewwkplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bi4C (C:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bi4C (C:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtdghdrryainaekmknefdwepkytfeqglqetvqwy
    ekneewwkplk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bi4D (D:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bi4D (D:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtghdrryainaekmknefdwepkytfeqglqetvqwye
    kneewwkplk