PDB entry 6bht

View 6bht on RCSB PDB site
Description: HIV-1 CA hexamer in complex with IP6, orthorhombic crystal form
Class: viral protein
Keywords: assembly, co-factor, VIRAL PROTEIN
Deposited on 2017-10-31, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhta1, d6bhta2
  • Chain 'B':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtb1, d6bhtb2
  • Chain 'C':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtc1, d6bhtc2
  • Chain 'D':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtd1, d6bhtd2
  • Chain 'E':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhte1, d6bhte2
  • Chain 'F':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtf1, d6bhtf2
  • Chain 'G':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtg1, d6bhtg2
  • Chain 'H':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhth1, d6bhth2
  • Chain 'I':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhti1, d6bhti2
  • Chain 'J':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtj1, d6bhtj2
  • Chain 'K':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d6bhtk1, d6bhtk2
  • Chain 'L':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d6bhtl1, d6bhtl2
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bhtA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    naatetllvqnanpdcktilkalgpgatleemmtacqgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bhtB (B:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtB (B:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpiapgqmreprgsdiagttstlqeqigwmthnppip
    vgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqanaatetll
    vqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bhtC (C:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtC (C:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bhtD (D:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtD (D:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpgqmreprgsdiagttstlqeqigwmthnppipvge
    iykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqenaatetll
    vqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bhtE (E:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtE (E:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvmreprgsdiagttstlqeqigwmthnppipvgei
    ykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetl
    lvqnanpdcktilkalgpgatleemmtacqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bhtF (F:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtF (F:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bhtG (G:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtG (G:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqn
    aatetllvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6bhtH (H:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtH (H:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6bhtI (I:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtI (I:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqknaa
    tetllvqnanpdcktilkalgpgatleemmtacqgv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6bhtJ (J:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtJ (J:)
    pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq
    aamqmlketineeaaewdrlhpvhagqmreprgsdiagttstlqeqigwmthnppipvge
    iykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatet
    llvqnanpdcktilkaatleemmtacq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6bhtK (K:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtK (K:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqatetllvqnanpdc
    ktilkalgpgatleemmtacq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6bhtL (L:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhtL (L:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvmreprgsdiagttstlqeqigwmthnppipvgei
    ykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasnaatetllvqn
    anpdcktilkaltleemmtacq