SCOPe 2.08: Structural Classification of Proteins

PDB entry 6bht

View 6bht on RCSB PDB site
Description: HIV-1 CA hexamer in complex with IP6, orthorhombic crystal form
Class: viral protein
Keywords: assembly, co-factor, VIRAL PROTEIN
Deposited on 2017-10-31, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhta1, d6bhta2
Chain 'B':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtb1, d6bhtb2
Chain 'C':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtc1, d6bhtc2
Chain 'D':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtd1, d6bhtd2
Chain 'E':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhte1, d6bhte2
Chain 'F':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtf1, d6bhtf2
Chain 'G':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtg1, d6bhtg2
Chain 'H':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhth1, d6bhth2
Chain 'I':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhti1, d6bhti2
Chain 'J':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtj1, d6bhtj2
Chain 'K':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (184)
Domains in SCOPe 2.08: d6bhtk1, d6bhtk2
Chain 'L':
Compound: capsid protein p24
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P12493 (0-End)
  - engineered mutation (13)
  - engineered mutation (44)
  - engineered mutation (183-184)
Domains in SCOPe 2.08: d6bhtl1, d6bhtl2
Heterogens: IHP, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6bhtA (A:)
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl