PDB entry 6bhs

View 6bhs on RCSB PDB site
Description: HIV-1 CA hexamer in complex with IP6, hexagonal crystal form
Class: viral protein
Keywords: assembly, co-factor, VIRAL PROTEIN
Deposited on 2017-10-31, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate NY5) [TaxId:11698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d6bhsa1, d6bhsa2
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bhsA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhsA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhpiapgqmreprgsdiagttstlqeqigwmthnp
    pipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqetllvq
    nanpdcktilkalgpgatleemmtacq