PDB entry 6bhr

View 6bhr on RCSB PDB site
Description: HIV-1 immature CTD-SP1 hexamer in complex with IP6
Class: viral protein
Keywords: assembly, co-factor, VIRAL PROTEIN
Deposited on 2017-10-31, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Capsid protein p24,Spacer peptide 1
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bhrg_
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bhrG (G:)
    sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
    gpaatleemmtacqgvggpghkarvlaeamsqvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhrG (G:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    aatleemmtacqgvggpghkarvlaeamsqv