PDB entry 6bhl

View 6bhl on RCSB PDB site
Description: Phosphotriesterase variant S5deltaL7
Class: hydrolase
Keywords: phosphotriesterase, organophosphate hydrolase, epistasis, directed evolution, laboratory evolution, HYDROLASE
Deposited on 2017-10-30, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A060GSX0
      • conflict (183)
      • conflict (200)
      • conflict (221)
      • conflict (251)
      • conflict (271)
      • conflict (278)
    Domains in SCOPe 2.07: d6bhla_
  • Chain 'G':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A060GSX0
      • conflict (183)
      • conflict (200)
      • conflict (221)
      • conflict (251)
      • conflict (271)
      • conflict (278)
    Domains in SCOPe 2.07: d6bhlg_
  • Heterogens: ZN, MPD, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bhlA (A:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaileseglspsrvcighsdatddlsyltalaargyligldsiphsaigledirswqtra
    llikalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgi
    pqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhlA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
    aileseglspsrvcighsdatddlsyltalaargyligldsiphsaigledirswqtral
    likalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgip
    qetlagitvtnparflsptl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bhlG (G:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaileseglspsrvcighsdatddlsyltalaargyligldsiphsaigledirswqtra
    llikalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgi
    pqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhlG (G:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
    aileseglspsrvcighsdatddlsyltalaargyligldsiphsaigledirswqtral
    likalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgip
    qetlagitvtnparflspt