PDB entry 6bhk

View 6bhk on RCSB PDB site
Description: Phosphotriesterase variant R18deltaL7
Class: hydrolase
Keywords: phosphotriesterase, organophosphate hydrolase, epistasis, directed evolution, laboratory evolution, HYDROLASE
Deposited on 2017-10-30, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bhka_
  • Chain 'B':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bhkb_
  • Chain 'E':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bhke_
  • Chain 'G':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bhkg_
  • Heterogens: ZN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bhkA (A:)
    mgdrintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrrara
    agvrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflr
    eiqygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqq
    aaifeseglspsrvcighsdetddlsyltalaargyligldriphsaigledsrswqtra
    llikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgi
    pqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhkA (A:)
    gdrintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrraraa
    gvrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflre
    iqygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqqa
    aifeseglspsrvcighsdetddlsyltalaargyligldriphsaidsrswqtrallik
    alidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgipqet
    lagitvtnparflsptlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bhkB (B:)
    mgdrintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrrara
    agvrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflr
    eiqygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqq
    aaifeseglspsrvcighsdetddlsyltalaargyligldriphsaigledsrswqtra
    llikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgi
    pqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhkB (B:)
    gdrintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrraraa
    gvrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflre
    iqygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqqa
    aifeseglspsrvcighsdetddlsyltalaargyligldriphsaigledsrswqtral
    likalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgip
    qetlagitvtnparflsptl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6bhkE (E:)
    mgdrintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrrara
    agvrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflr
    eiqygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqq
    aaifeseglspsrvcighsdetddlsyltalaargyligldriphsaigledsrswqtra
    llikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgi
    pqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhkE (E:)
    drintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrraraag
    vrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflrei
    qygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqqaa
    ifeseglspsrvcighsdetddlsyltalaargyligldriphsaigledsrswqtrall
    ikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgipq
    etlagitvtnparflsptl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6bhkG (G:)
    mgdrintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrrara
    agvrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflr
    eiqygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqq
    aaifeseglspsrvcighsdetddlsyltalaargyligldriphsaigledsrswqtra
    llikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgi
    pqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bhkG (G:)
    drintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrraraag
    vrtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflrei
    qygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqqaa
    ifeseglspsrvcighsdetddlsyltalaargyligldriphsaigsrswqtrallika
    lidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipflrekgipqetl
    agitvtnparflsptl