PDB entry 6bge

View 6bge on RCSB PDB site
Description: helicobacter pylori ATPase, hp0525, in complex with 1g4 compound
Class: ATP binding Protein
Keywords: ATP binding Protein
Deposited on 2017-10-27, released 2018-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VirB11-like protein
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP0525, HPY1846_06315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bgea_
  • Chain 'B':
    Compound: VirB11-like protein
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP0525, HPY1846_06315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bgeb_
  • Heterogens: SO4, GOL, EPE, DN7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bgeA (A:)
    lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
    qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
    etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
    tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
    lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
    fkdlidmivhinhhkqcdefyik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bgeB (B:)
    lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
    qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
    etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
    tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
    lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
    fkdlidmivhinhhkqcdefyik