PDB entry 6bfp

View 6bfp on RCSB PDB site
Description: Bovine trypsin bound to potent inhibitor
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: trypsin protease, HYDROLASE, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2017-10-26, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bfpa_
  • Heterogens: CA, DJY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bfpA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfpA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkstsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvv
    csgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn