PDB entry 6bdn

View 6bdn on RCSB PDB site
Description: Crystal structure of human TAO3 kinase binding ADP
Class: transferase
Keywords: TAOK3, transferase, kinase, Serine/threonine-protein kinase, ADT-binding, MAPK cascade
Deposited on 2017-10-23, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase TAO3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAOK3, DPK, JIK, KDS, MAP3K18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bdna_
  • Heterogens: ADP, MG, PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bdnA (A:)
    plgsmaagvlkdpeiadlfykddpeelfiglheighgsfgavyfatnahtsevvaikkms
    ysgkqthekwqdilkevkflrqlkhpntieykgcylkehtawlvmeyclgsasdllevhk
    kplqeveiaaithgalhglaylhshalihrdikagnilltepgqvkladfgsasmaspan
    sfvgtpywmapevilamdegqydgkvdiwslgitcielaerkpplfnmnamsalyhiaqn
    dsptlqsnewtdsfrrfvdyclqkipqerptsaellrhdfvrrdrplrvlidliqrtkda
    vreldnlqyrkmkkilfqet
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bdnA (A:)
    dpeiadlfykddpeelfiglheighgsfgavyfatnahtsevvaikkmsysgkqthekwq
    dilkevkflrqlkhpntieykgcylkehtawlvmeyclgsasdllevhkkplqeveiaai
    thgalhglaylhshalihrdikagnilltepgqvkladfgsasmaspansfvgtpywmap
    evilamdegqydgkvdiwslgitcielaerkpplfnmnamsalyhiaqndsptlqsnewt
    dsfrrfvdyclqkipqerptsaellrhdfvrrdrplrvlidliqrtkdavreldnlqyrk
    mkkilfq