PDB entry 6bd3

View 6bd3 on RCSB PDB site
Description: Saccharomyces cerevisiae acetohydroxyacid synthase
Class: transferase
Keywords: AHAS, FAD, 2-hydroxyethyl-ThDP, dioxygen, TRANSFERASE
Deposited on 2017-10-21, released 2017-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase catalytic subunit, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bd3a1, d6bd3a2, d6bd3a3
  • Chain 'B':
    Compound: Acetolactate synthase catalytic subunit, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bd3b1, d6bd3b2, d6bd3b3
  • Heterogens: K, MG, TPP, OXY, CO2, FAD, HTL, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bd3A (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bd3A (A:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpsdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtt
    tlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapear
    raaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqink
    wkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnp
    htfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkil
    ilnneshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bd3B (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bd3B (B:)
    dmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgag
    hmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqe
    advvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
    tkttlpsqltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdra
    qipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgnisk
    fapearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersew
    faqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqh
    wtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqag
    tpvkililnneeqgmvtqwqslfyshthqlnpdfiklaeamglkglrvkkqeeldaklke
    fvstkgpvllevevdkkv