PDB entry 6bck

View 6bck on RCSB PDB site
Description: Crystal Structure of Broadly Neutralizing Antibody N49P7 in Complex with HIV-1 Clade AE strain 93TH057 gp120 core.
Class: viral protein/immune system
Keywords: HIV-1, VRC01-CLASS ANTIBODY, CD4 binding site, CLADE A/E 93TH057 gp120, viral protein-immune system complex, N49P7, IMMUNE SYSTEM
Deposited on 2017-10-20, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: clade A/E 93TH057 HIV-1 gp120 core
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KKW9 (0-End)
      • engineered mutation (241)
  • Chain 'H':
    Compound: N49P7 Fab heavy chain of N29P7 IgG
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BCK (0-End)
  • Chain 'L':
    Compound: N49P7 Fab light chain from N49P7 IgG
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BCK
    Domains in SCOPe 2.07: d6bckl1, d6bckl2
  • Heterogens: NAG, MPD, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6bckL (L:)
    qsaltqprsvsaspgqsvtisctgthnlvswcqhqpgrapklliydfnkrpsgvpdrfsg
    sgsggtasltitglqddddaeyfcwayeafgggtkltvlgqpkaapsvtlfppsseelqa
    nkatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeqwks
    hrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bckL (L:)
    altqprsvsaspgqsvtisctgthnlvswcqhqpgrapklliydfnkrpsgvpdrfsgsg
    sggtasltitglqddddaeyfcwayeafgggtkltvlgqpkaapsvtlfppsseelqank
    atlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeqwkshr
    syscqvthegstvektvap