PDB entry 6bbl

View 6bbl on RCSB PDB site
Description: Crystal structure of the a-96Gln MoFe protein variant in the presence of the substrate acetylene
Class: oxidoreductase, electron transport
Keywords: Nitrogenase, N2 reduction, FeMo-cofactor, substrate binding, acetylene, OXIDOREDUCTASE, ELECTRON TRANSPORT
Deposited on 2017-10-18, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07328
      • engineered mutation (95)
    Domains in SCOPe 2.07: d6bbla_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bblb_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07328
      • engineered mutation (95)
    Domains in SCOPe 2.07: d6bblc_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bbld_
  • Heterogens: C2H, IMD, HCA, ICS, 1CL, FE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bblA (A:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragqrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bblA (A:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragqrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bblB (B:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bblB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bblC (C:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragqrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bblC (C:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragqrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bblD (D:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bblD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr