PDB entry 6bbe

View 6bbe on RCSB PDB site
Description: Structure of N-glycosylated porcine surfactant protein-D
Class: surfactant protein
Keywords: innate immunity, surfactant, N-linked glycan, C-type lectin, SURFACTANT PROTEIN
Deposited on 2017-10-18, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Sus scrofa [TaxId:9823]
    Gene: SFTPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bbea1, d6bbea2
  • Heterogens: CA, NAG, BMA, MAN, 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bbeA (A:)
    gitalrqqvetlqgqvqrlqkafsqykkvelfpngrgvgekifktggfektfqdaqqvct
    qaggqmasprsetenealsqlvtaqnkaaflsmtdiktegnftyptgeplvyanwapgep
    nnnggssgaencveifpngkwndkacgelrlvicef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bbeA (A:)
    italrqqvetlqgqvqrlqkafsqykkvelfpngrgvgekifktggfektfqdaqqvctq
    aggqmasprsetenealsqlvtaqnkaaflsmtdiktegnftyptgeplvyanwapgepn
    nnggssgaencveifpngkwndkacgelrlvicef