PDB entry 6baw

View 6baw on RCSB PDB site
Description: Structure of GRP94 with a selective resorcinylic inhibitor.
Class: chaperone/inhibitor
Keywords: CHAPERONE-INHIBITOR complex
Deposited on 2017-10-16, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bawa_
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bawb_
  • Chain 'C':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (Start-221)
      • linker (222-225)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.07: d6bawc_
  • Chain 'D':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (Start-221)
      • linker (222-225)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.07: d6bawd_
  • Heterogens: D57, EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bawA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bawA (A:)
    fafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvk
    ikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflqstseligqfgvgfysaflv
    adkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtik
    nlvkkysqfinfpiyvwssktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bawB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bawB (B:)
    fafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvk
    ikcdkeknllhvtdtgvgmtreelvknlgtiaksgtsefstseligqfgvgfysaflvad
    kvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknl
    vkkysqfinfpiyvwsskttvwdwelmn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bawC (C:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bawC (C:)
    ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
    vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtsqstseligqfgvgfysaflva
    dkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtikn
    lvkkysqfinfpiyvwssktggggktvwdwelmn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6bawD (D:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bawD (D:)
    ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
    vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtsgqstseligqfgvgfysaflv
    adkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtik
    nlvkkysqfinfpiyvwssktggggktvwdwelmn