PDB entry 6ban

View 6ban on RCSB PDB site
Description: Potent and Selective Antitumor Activity of a T-Cell Engaging Bispecific Antibody Targeting a Membrane-Proximal Epitope of ROR1
Class: immune system
Keywords: Single chain Fv, ScFv, Antibody, ROR1, Kringle domain, receptor tyrosine kinase-like orphan receptor, Phage display, IMMUNE SYSTEM
Deposited on 2017-10-14, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Variable domain of R11 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN (Start-113)
    Domains in SCOPe 2.07: d6bana_
  • Chain 'B':
    Compound: Variable domain R11 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN
  • Chain 'C':
    Compound: Variable domain of R11 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN (Start-113)
    Domains in SCOPe 2.07: d6banc_
  • Chain 'D':
    Compound: Variable domain R11 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN
    Domains in SCOPe 2.07: d6band_
  • Chain 'E':
    Compound: Variable domain of R11 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN (Start-113)
    Domains in SCOPe 2.07: d6bane_
  • Chain 'F':
    Compound: Variable domain R11 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN
    Domains in SCOPe 2.07: d6banf_
  • Chain 'G':
    Compound: Variable domain of R11 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN (Start-113)
    Domains in SCOPe 2.07: d6bang_
  • Chain 'H':
    Compound: Variable domain R11 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BAN
    Domains in SCOPe 2.07: d6banh_
  • Chain 'M':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6banm_
  • Chain 'N':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bann_
  • Chain 'O':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bano_
  • Chain 'P':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6banp_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6banA (A:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banA (A:)
    melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
    srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6banC (C:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banC (C:)
    melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
    srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6banD (D:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banD (D:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6banE (E:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banE (E:)
    melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
    srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6banF (F:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banF (F:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6banG (G:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banG (G:)
    melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
    srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6banH (H:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banH (H:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6banM (M:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banM (M:)
    hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
    apwcftldenfksdlcdipac
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6banN (N:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banN (N:)
    hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
    apwcftldenfksdlcdipac
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6banO (O:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banO (O:)
    hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
    apwcftldenfksdlcdipac
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6banP (P:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6banP (P:)
    hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
    apwcftldenfksdlcdipac