PDB entry 6ba6

View 6ba6 on RCSB PDB site
Description: Solution structure of Rap1b/talin complex
Class: cell adhesion
Keywords: Complex, Small GTPase, ubiquitin-like fold, CELL ADHESION
Deposited on 2017-10-12, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61224 (1-167)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6ba6b_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6ba6B (B:)
hmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildta
gteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcd
ledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

    Sequence, based on observed residues (ATOM records): (download) 
    >6ba6B (B:)
mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr