PDB entry 6ba4

View 6ba4 on RCSB PDB site
Description: Crystal structure of MYST acetyltransferase domain in complex with Acetyl-CoA cofactor
Class: transferase
Keywords: acetyltransferase, complex, MYST, TRANSFERASE
Deposited on 2017-10-12, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT8, MOF, MYST1, PP7073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7Z6
      • conflict (94)
      • conflict (160)
      • conflict (163-164)
      • conflict (175)
      • conflict (212)
      • conflict (217)
    Domains in SCOPe 2.08: d6ba4a_
  • Heterogens: ZN, NA, ACO, 7L1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ba4A (A:)
    mgsshhhhhhssglvprgstkvkyvdkihignyeidawyfspfpedygkqpklwlceycl
    kymkyeksyrfhlgqcqwrqppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhk
    tlyfdvepfvfyiltevdrqgahivgyfskekespdgnnvscimilppyqrrgygrflia
    fsyelsklestvgspekplsdlgklsyrsywssvllenlrdfrgtlsikdlsqmtsitqn
    diistlqslnmvkywkgqhvicvtpklveehlksaqykkppitvdsvclkwappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba4A (A:)
    kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
    gkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
    hivgyfskekespdgnnvscimilppyqrrgygrfliafsyelsklestvgspekplsdl
    gklsyrsywssvllenlrdlsikdlsqmtsitqndiistlqslnmvkywkgqhvicvtpk
    lveehlksaqykkppitvdsvclkwapp