PDB entry 6ba0

View 6ba0 on RCSB PDB site
Description: Pyrimidine-specific Ribonucleoside Hydrolase from Gardnerella vaginalis
Class: hydrolase
Keywords: Nucleoside hydrolase, Nitrogen metabolism, HYDROLASE
Deposited on 2017-10-11, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine/uridine-specific hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: rihA, HMPREF9435_0920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba0a_
  • Chain 'B':
    Compound: Cytidine/uridine-specific hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: rihA, HMPREF9435_0920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba0b_
  • Chain 'C':
    Compound: Cytidine/uridine-specific hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: rihA, HMPREF9435_0920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba0c_
  • Chain 'D':
    Compound: Cytidine/uridine-specific hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: rihA, HMPREF9435_0920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba0d_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ba0A (A:)
    gshmttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemaha
    tnipvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepg
    titlvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvv
    fnedwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidpp
    vhdpctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldf
    nkfwdliidalkelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba0A (A:)
    mttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemahatni
    pvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepgtit
    lvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvvfne
    dwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidppvhd
    pctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldfnkf
    wdliidalkelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ba0B (B:)
    gshmttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemaha
    tnipvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepg
    titlvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvv
    fnedwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidpp
    vhdpctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldf
    nkfwdliidalkelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba0B (B:)
    mttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemahatni
    pvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepgtit
    lvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvvfne
    dwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidppvhd
    pctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldfnkf
    wdliidalkelk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ba0C (C:)
    gshmttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemaha
    tnipvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepg
    titlvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvv
    fnedwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidpp
    vhdpctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldf
    nkfwdliidalkelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba0C (C:)
    mttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemahatni
    pvhagcdrpmirplevgldgvtlpeptrpldeghavnwiidtimshepgtitlvptgplt
    niamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvvfnedwpitmvg
    ldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidppvhdpctvayli
    dhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldfnkfwdliidal
    kelk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ba0D (D:)
    gshmttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemaha
    tnipvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepg
    titlvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvv
    fnedwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidpp
    vhdpctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldf
    nkfwdliidalkelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba0D (D:)
    mttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemahatni
    pvhagcdrpmirplevgldgvtlpeptrpldeghavnwiidtimshepgtitlvptgplt
    niamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvvfnedwpitmvg
    ldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidppvhdpctvayli
    dhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldfnkfwdliidal
    kelk