PDB entry 6b9z

View 6b9z on RCSB PDB site
Description: Trastuzumab Fab v3
Class: immune system
Keywords: monoclonal antibody, Fab, IMMUNE SYSTEM
Deposited on 2017-10-11, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trastuzumab Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 6B9Z (0-106)
    • Uniprot P01834 (107-213)
    Domains in SCOPe 2.07: d6b9za1, d6b9za2
  • Chain 'B':
    Compound: Trastuzumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B9Z (0-107)
    • Uniprot S6B291 (108-End)
      • engineered mutation (174)
      • engineered mutation (216)
  • Chain 'C':
    Compound: immunoglobulin g binding protein a
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2UW42 (3-53)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6b9zc1, d6b9zc2
  • Chain 'E':
    Compound: protein l
    Species: Finegoldia magna [TaxId:1260]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51918 (3-63)
      • expression tag (1-2)
      • engineered mutation (16)
      • engineered mutation (37)
      • engineered mutation (55-57)
    Domains in SCOPe 2.07: d6b9ze1, d6b9ze2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6b9zA (A:)
diqmtqspillsasvgdrvtitcrasqdvntavawyqqrtngsprlliysasflysgvps
rfsgsrsgtdftltisslqpedeadyycqqhyttpptfgagtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6b9zC (C:)
gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >6b9zE (E:)
gsevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmni
kfag

    Sequence, based on observed residues (ATOM records): (download) 
    >6b9zE (E:)
sevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnik
fag