PDB entry 6b9x

View 6b9x on RCSB PDB site
Description: Crystal structure of Ragulator
Class: signaling protein
Keywords: Ragulator, Lamtor, SIGNALING PROTEIN
Deposited on 2017-10-11, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2Q5 (1-125)
      • expression tag (0)
    Domains in SCOPe 2.06: d6b9xb1, d6b9xb2
  • Chain 'C':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6b9xc_
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hepatitis B virus x interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, hCG_40252
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b9xB (B:)
    amlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
    gnqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
    tqvaas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b9xC (C:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
    vevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9xC (C:)
    addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
    klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv
    e
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.