PDB entry 6b9j

View 6b9j on RCSB PDB site
Description: Structure of vaccinia virus D8 protein bound to human Fab vv138
Class: VIRAL PROTEIN/immune system
Keywords: viral protein, antibody, Fab, Immune response, Ig fold, VIRAL PROTEIN-Immune System complex
Deposited on 2017-10-10, released 2017-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab vv138 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B9J (0-216)
  • Chain 'B':
    Compound: Fab vv138 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B9J (Start-214)
    Domains in SCOPe 2.06: d6b9jb1, d6b9jb2
  • Chain 'H':
    Compound: Fab vv138 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B9J (0-216)
  • Chain 'L':
    Compound: Fab vv138 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B9J (Start-214)
    Domains in SCOPe 2.06: d6b9jl1, d6b9jl2
  • Chain 'X':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: VAC_DPP17_124, VACAC2_124, VACCL3_124
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1M1K6 (Start-234)
      • expression tag (235)
    Domains in SCOPe 2.06: d6b9jx1, d6b9jx2
  • Chain 'Y':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: VAC_DPP17_124, VACAC2_124, VACCL3_124
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1M1K6 (Start-234)
      • expression tag (235)
    Domains in SCOPe 2.06: d6b9jy1, d6b9jy2
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b9jB (B:)
    eivltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygssppytfgqgtkvdikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9jB (B:)
    ivltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgipd
    rfsgsgstdftltisrlepedfavyycqqygssppytfgqgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6b9jL (L:)
    eivltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygssppytfgqgtkvdikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9jL (L:)
    ivltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliyssratgipdrf
    sgsgsgtdftltisrlepedfavyycqqygpytfgqgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6b9jX (X:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9jX (X:)
    pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
    vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
    qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
    wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysgh
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6b9jY (Y:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9jY (Y:)
    pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
    vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
    qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
    wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysgh