PDB entry 6b9c

View 6b9c on RCSB PDB site
Description: Superfolder Green Fluorescent Protein with 4-nitro-L-phenylalanine at the chromophore (position 66)
Class: fluorescent protein
Keywords: Unnatural amino acid, chromophore, FLUORESCENT PROTEIN
Deposited on 2017-10-10, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (Start-236)
      • engineered mutation (30)
      • chromophore (65)
      • engineered mutation (70)
      • engineered mutation (78)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d6b9ca_
  • Heterogens: CO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b9cA (A:)
    mvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwpt
    lvttlxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
    rielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh
    yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9cA (A:)
    geelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvtt
    lxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnriel
    kgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyqqn
    tpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithgmdelyk