PDB entry 6b9b

View 6b9b on RCSB PDB site
Description: Crystal structure of the catalase-peroxidase from B. pseudomallei with maltose bound
Class: oxidoreductase
Keywords: catalase, peroxidase, maltose, heme, OXIDOREDUCTASE
Deposited on 2017-10-10, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b9ba1, d6b9ba2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b9bb1, d6b9bb2
  • Heterogens: HEM, NA, CL, OXY, PO4, MPD, MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b9bA (A:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9bA (A:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b9bB (B:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9bB (B:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla