PDB entry 6b9a

View 6b9a on RCSB PDB site
Description: Hsp90-alpha N-domain bound to NPCA
Class: chaperone/inhibitor
Keywords: Chaperone, Hsp90, Inhibitor, CHAPERONE-INHIBITOR complex
Deposited on 2017-10-10, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b9aa_
  • Chain 'B':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b9ab_
  • Heterogens: PA7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b9aA (A:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9aA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfveke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b9aB (B:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b9aB (B:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfvek