PDB entry 6b94

View 6b94 on RCSB PDB site
Description: Crystal structure of Human galectin-1 in complex with Lactulose
Class: sugar binding protein
Keywords: Galectin-1, SUGAR BINDING PROTEIN
Deposited on 2017-10-09, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6b94a_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6b94b_
  • Heterogens: BME, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b94A (A:)
    acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b94B (B:)
    acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd