PDB entry 6b8f

View 6b8f on RCSB PDB site
Description: Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
Class: oxidoreductase
Keywords: Oxidoreductase, Hydrogel, Polymer
Deposited on 2017-10-07, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • conflict (85)
      • conflict (89)
      • conflict (101)
      • conflict (129)
    Domains in SCOPe 2.07: d6b8fa_
  • Heterogens: FE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b8fA (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    atdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b8fA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklatdk
    ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg