PDB entry 6b83

View 6b83 on RCSB PDB site
Description: Crystal structure of Myotoxin II from Bothrops moojeni complexed to Caproic acid
Class: toxin
Keywords: Myotoxin II, Bothrops moojeni, Phospholipase A2-like, TOXIN
Deposited on 2017-10-05, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I834 (0-121)
      • conflict (114)
    Domains in SCOPe 2.08: d6b83a_
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I834 (0-121)
      • conflict (114)
    Domains in SCOPe 2.08: d6b83b_
  • Heterogens: 6NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b83A (A:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad
    pc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b83B (B:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad
    pc