PDB entry 6b7k

View 6b7k on RCSB PDB site
Description: GH43 Endo-Arabinanase from Bacillus licheniformis
Class: hydrolase
Keywords: Arabinanase, Bacillus licheniformis, GH43, HYDROLASE
Deposited on 2017-10-04, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) [TaxId:279010]
    Gene: abnA, BL00353
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b7ka_
  • Chain 'B':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) [TaxId:279010]
    Gene: abnA, BL00353
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b7kb_
  • Chain 'C':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) [TaxId:279010]
    Gene: abnA, BL00353
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b7kc_
  • Chain 'D':
    Compound: Endo-alpha-(1->5)-L-arabinanase
    Species: Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) [TaxId:279010]
    Gene: abnA, BL00353
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b7kd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b7kA (A:)
    sfsmpesgkaafwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaaps
    ifptplswwkmyvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgq
    wrddglvirstsgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslys
    iasrpnnggaveapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgk
    nmmngggtildsgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b7kA (A:)
    fwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaapsifptplswwkm
    yvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgqwrddglvirst
    sgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslysiasrpnnggav
    eapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgknmmngggtild
    sgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b7kB (B:)
    sfsmpesgkaafwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaaps
    ifptplswwkmyvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgq
    wrddglvirstsgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslys
    iasrpnnggaveapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgk
    nmmngggtildsgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b7kB (B:)
    fwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaapsifptplswwkm
    yvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgqwrddglvirst
    sgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslysiasrpnnggav
    eapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgknmmngggtild
    sgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpty
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b7kC (C:)
    sfsmpesgkaafwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaaps
    ifptplswwkmyvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgq
    wrddglvirstsgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslys
    iasrpnnggaveapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgk
    nmmngggtildsgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b7kC (C:)
    fwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaapsifptplswwkm
    yvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgqwrddglvirst
    sgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslysiasrpnnggav
    eapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgknmmngggtild
    sgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpty
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6b7kD (D:)
    sfsmpesgkaafwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaaps
    ifptplswwkmyvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgq
    wrddglvirstsgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslys
    iasrpnnggaveapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgk
    nmmngggtildsgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b7kD (D:)
    fwdtkgdnfihdpsiikegntwytfgtglgtglrvikstdgrnwsaapsifptplswwkm
    yvpnhephqwapdisyyngrywlyysvssfgsntsaiglastdrissgqwrddglvirst
    sgdqfnaidpdlvidkdgnpwlsfgsfwsgikltrldkntmkptgslysiasrpnnggav
    eapnitykdgyyylfvsfdscckgvdstykiaygrstsitgpyydksgknmmngggtild
    sgndrwkgpghqdvlnnsilvrhaydaldngvskllindlywdsqgwpty