PDB entry 6b7h

View 6b7h on RCSB PDB site
Description: Structure of mGluR3 with an agonist
Class: membrane protein/agonist
Keywords: mGluR3 Glutamate, MEMBRANE PROTEIN-AGONIST complex
Deposited on 2017-10-04, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM3, GPRC1C, MGLUR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14832 (Start-508)
      • conflict (241)
      • expression tag (509)
    Domains in SCOPe 2.07: d6b7ha1, d6b7ha2
  • Heterogens: NAG, CWY, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b7hA (A:)
    malkmltrlqvltlalfskgfllslgdhnflrreikiegdlvlgglfpinekgtgteecg
    rinedrgiqrleamlfaideinkddyllpgvklgvhildtcsrdtyaleqslefvraslt
    kvdeaeymcpdgsyaiqeniplliagviggsyssvsiqvanllrlfqipqisyastsakl
    sdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafeqearlrn
    isiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaasranasftwv
    asdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwfrdfweqk
    fqcslqnkrnhrrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttkl
    cdamkildgkklykdyllkinftapfnpnkdadsivkfdtfgdgmgrynvfnfqnvggky
    sylkvghwaetlsldvnsihwsrnsvptseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b7hA (A:)
    rreikigdlvlgglfpinekeecgrinedrgiqrleamlfaideinkddyllpgvklgvh
    ildtcsrdtyaleqslefvraslplliagviggsyssvsiqvanllrlfqipqisyasts
    aklsdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafeqear
    lrnisiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaasranasf
    twvasdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwfrdfw
    eqkfqcslrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttklcdam
    kildgkklykdyllkinftapdadsivkfdtfgdgmgrynvfnfqnvggkysylkvghwa
    etlsldvnsihwsrnsvptse